Human IgG2 Fc, His tag
SKU: 27059733163

Human IgG2 Fc, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 Fc, His tagProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), with C 10*His)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence Protein sequence(P01859, Glu99-Lys326(V161M, S257A), with C-10*His) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.4kDa Actual:32kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27059733163

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 58 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Niccat
Lake Worth, US
★★★★★ 5
Gus the goose Buster's new bff
My pitbull terrier loves his goose and has not tore this up but he had not tried either. He's funny with soft toys but loves A good tug of war or actual chew toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
R
R. Damien Hart
Waukegan, US
★★★★★ 5
Fun Goose Dog Toy
I have a small dog with about 20 plush toys to play with. Added to her inventory now is the ILC Buy Interactive Goose Toy for Small Breeds. It took me a while to figure out where the toy "squeaks", and it makes the noise when the white banded neck around the goose is squeezed. My dog took an immediate liking to the toy and loves to carry it around the house, shaking her head back and forth with the goose in her mouth. It appears to be made primarily of burlap (see pictures) and is about 12-13" in length. Fortunately, my dog doesn't destroy toys, as some (probably larger) dogs do, so it appears to be pretty sturdy and well-made. After a week of playing with it regularly, the toy still looks brand new. I like the coloring and the size of the goose, and this is a nice addition to my dog's playtime routine. It is also priced appropriately for a dog toy of its size and quality. Recommended. Made in China.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
K
Kelly G. Burgess
Birmingham, US
★★★★★ 4
Durable toy with a single squeaker
This goose seems to be made of fairly durable fabric. It's not flimsy. I had a hard time finding the squeaker in it at first, but then I realized the squeaker is located in the white neck! My medium border collie grabbed it first. Then my pitbull figured out where the squeaker was and ran around squeaking it for a while, which is her favorite thing to do. So this toy did get some interest from the pitbull especially. She isn't one to chew things up but really enjoys toys that make noise. Since the squeaker is in the skinny neck portion, it made it easy for her to grab hold of it and squeak it over and over again. I am giving this 4 stars only because in the whole long body of this toy, the neck has the only squeaker. I think it would have been better and more stimulating for my dogs if it had multiple squeakers or even some crinkles in the rest of the body...at least some crinkles in the flat feet of the duck. The sole attraction is that one squeaker in the neck. So it could be better, but I do like that it isn't super plush and full of stuffing that would be torn up in 5 minutes like most toys. My pitbull actually took this to another room away from her three sisters, so that means she really wanted to play with this by herself. That's a good sign.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
H
Happy Face
Phoenix, US
★★★★★ 5
Duck-time is play-time! Exactly what a dog toy should be!
Duck hunting for your living-room princess-pal best buddy goodest puppy in the world! Every dog deserves a chance to be a heroic duck hunting hero! This dog toy is a favorite of my pup. Duck-time is play time! This duck is made with several fabulous textures. There's a ropey texture around the neck, a burlap type texture for the body and head, and a felt-like texture for the bill and feet. My dog immediately tore the feet off! He always removes any hanging bits from all toys, so that's not a comment to the detriment of this product. He's working on the wings, now. My dog likes to chase this toy when I throw it or play tug-of-war with it, or is willing to sit and chomp on it by himself for a while. The rope is intact, still! This is exactly what a dog toy should be! Give your little buddy a hunting trophy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
B
Buyerone
Pawtucket, US
★★★★★ 2
Speaker broken
This toy is advertised as having a squeaker, but the one we had was defective and did not make any noise. Our dog still throughly enjoyed ripping this little duck to shreds through. The material was thicker than I was expecting but still only took our dog about 5 mins to completely destroy it (Golden retriever). I understand that this toy is marketed as for small dogs so I get that, but took away three starts because our came with the broken squeaker and for $10, you can find a lot better toys at TJ Max. This item is not a good value for our experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2025

recommand products