Human IgG2 Fc
SKU: 2891188935

Human IgG2 Fc

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 FcProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), no tag)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), no tag) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.7kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag N/A
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2891188935

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 671 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
✧˖° Jeanne Lee ✧˖°
Cuba, US
★★★★★ 5
A Versatile and Elegant Solution for Room Separation
I recently purchased the GOFLAME 8 Panel Room Divider, and I'm thoroughly impressed with its quality and design. This room divider is not only a decorative element, but it also provides a practical solution for creating distinct areas within a room. Here's why I'm giving it a 5-star review: Enhanced Privacy Space: The 6 ft tall room divider is perfect for creating a private space within a larger room. It's ideal for my home office, and I can use it to separate my workspace from the rest of the room. The screen also creates a cozy and intimate atmosphere, making it perfect for relaxing or reading. Hand-woven Texture: The unique hand-woven texture of the room divider adds an element of sophistication and warmth to my room. The intricate craftsmanship is impressive, and it exudes artisanal charm. I love the way it looks, and it's become a conversation piece in my home. Built with Strength: The solid wood frame is sturdy and well-constructed, providing reliable support for the room divider. I'm impressed by the attention to detail and the quality of the materials used. Foldable Design and Easy Storage: The foldable design of the room divider makes it easy to store when not in use. I can simply fold the panels flat and store them away, which is convenient and space-saving. The metal hinges that connect the panels are also sturdy and well-made. No Assembly Required: I was pleasantly surprised to find that the room divider requires no assembly. I simply took it out of the box and set it up, and it was ready to use. The smooth woven surface is also easy to clean and maintain. Overall Impression: I'm thoroughly impressed with the GOFLAME 8 Panel Room Divider. It's a stylish and functional solution for creating a private space within a larger room. The hand-woven texture and solid wood frame add an element of sophistication and warmth, and the foldable design makes it easy to store. I
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2024
B
Verified Purchase
Beverly D Clark
Grantham, US
★★★★★ 5
Quality product !
This is a quality lightweight room divider.! Actually is the second one of this type that I have bought. If you have an area that you just want to close off from the rest of the room, these work perfect!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2025
C
Verified Purchase
chuande tang
Lexington, US
★★★★★ 5
It suits me very well
I have a very large room. Its layout is perfect for me to convert into two rooms. Adding this screen is perfect and matches the style of my house.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2024
G
Verified Purchase
Gayla K.
Los Angeles, US
★★★★★ 5
Unable to see through it and no gap at bottom!
Size: 2-Panel, Size: 2-Panel
Used to divide a large upstairs common area and it’s perfect. Needed something that was tall enough to give privacy, but wouldn’t hit the ceiling fan. It’s just over 6ft tall, you can’t see through it and it goes almost all the way to floor, something that was difficult to find with similar products. It is a bit flimsy on the ends and needs some support to stay in place (our ceiling is slanted so it actually hit the slant perfectly and doesn’t move on one end and I put a small hook in the wall for the other end so that it could be moved if needed). Overall it’s great quality and gives the feeling of a separate area/private room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
T
Verified Purchase
THop
Draper, US
★★★★★ 5
Convenient, sturdy and worth the price
Size: 6-Panel, Size: 6-Panel
Exactly what I wanted. Yes, it took some time to put it together and at first, I was concerned about the sturdiness of it. However, once it all came together I am very happy with my purchase. It’s now stable but easily movable. It easily folds for storage. One of the ends readily folds in a single panel so I will be able to use it as an access door. Instructions were fairly straightforward, but takes a while to put it all together. (About an hour and a half ) but quality seems good and well worth the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 17, 2025

recommand products